PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0568s0087.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 228aa    MW: 26092.2 Da    PI: 6.5334
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0568s0087.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1975128457
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          ++++t+eq++ Le  F +++++   ++e++A +lgL+ rqV vWFqNrRa++k+
  Bostr.0568s0087.1.p  75 KRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKN 128
                          4589************************************************95 PP

2HD-ZIP_I/II120.21.1e-3874165293
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                          +kr+l++eqv++LE sF +e+kLe+ rK+++a eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+++  +++Le++v +L+e+l
  Bostr.0568s0087.1.p  74 RKRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNHHDTVVLGQCQLESQVLKLTEQL 163
                          8****************************************************************************************9 PP

          HD-ZIP_I/II  92 ke 93 
                          +e
  Bostr.0568s0087.1.p 164 SE 165
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.2E-1772133IPR001356Homeobox domain
PROSITE profilePS5007115.95374129IPR001356Homeobox domain
CDDcd000865.90E-1574130No hitNo description
SuperFamilySSF466892.05E-1774131IPR009057Homeodomain-like
PfamPF000461.1E-1675128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-2076136IPR009057Homeodomain-like
PRINTSPR000312.3E-5100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000312.3E-5109125IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MDHGRLMEDQ MVLGSQGYPY TTQTQNSQCI IVNQIDGSSS GKGSKPVKRR RKRRSKDSSA  60
TNEGDVAEIG GMLRKRKLTD EQVNMLEYSF GNEHKLESGR KEKIAGELGL DPRQVAVWFQ  120
NRRARWKNKK LEEEYAKLKN HHDTVVLGQC QLESQVLKLT EQLSEAQNEI RKLSERLEEM  180
STNSSSPSLS VEANDAQFDF ETNYNIPFYM LDNNYLQSME YWDGLSV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14753KRRRKRR
27277LRKRKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00591DAPTransfer from AT5G66700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6834770.0AY683477.1 Arabidopsis thaliana homeodomain protein (HB53) mRNA, complete cds.
GenBankBT0248470.0BT024847.1 Arabidopsis thaliana At5g66700 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866745.11e-135hypothetical protein ARALYDRAFT_332898
SwissprotQ9LVR01e-131ATB53_ARATH; Homeobox-leucine zipper protein ATHB-53
TrEMBLD7MME01e-135D7MME0_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_80022411e-134(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126021731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66700.11e-128homeobox 53